Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Gln22, Asn23) -Amyloid b-Protein (1-40) trifluoroacetate salt

Product Specifications

CAS Number

374796-75-5

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-Val-OH; H-DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV-OH

Smiles

C1COc2n1c3c (c (=O) n2) nsn3

Molecular Formula

C194H297N55O56S

Molecular Weight

4,327.84 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details