Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Gln22, Asn23) -Amyloid b-Protein (1-40) trifluoroacetate salt

Product Specifications

CAS Number

374796-75-5

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-Val-OH; H-DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV-OH

Smiles

C1COc2n1c3c (c (=O) n2) nsn3

Molecular Formula

C194H297N55O56S

Molecular Weight

4,327.84 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), CF405S conjugate, 0.1mg/mL
BNC042871-100 1x 100 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF405S conjugate, 0.1mg/mL
BNC041860-500 1x 500 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF405S conjugate, 0.1mg/mL
BNC040842-100 1x 100 µL

MUC2 (MLP/842), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (151), CF488A conjugate, 0.1mg/mL
BNC881852-100 1x 100 µL

BCL10 (MALT-Lymphoma Marker) (151), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF740 conjugate, 0.1mg/mL
BNC741687-100 1x 100 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details