Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Gln22) -Amyloid b-Protein (1-40) trifluoroacetate salt

Product Specifications

CAS Number

144410-00-4

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe -Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH; H-DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV-OH

Smiles

CC (=O) C1CCC2C1 (CCC3C2CC=C4C3 (CCC (C4) O) C) C

Molecular Formula

C194H296N54O57S

Molecular Weight

4,328.82 g/mol

Controlled

Yes

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-100 1x 100 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (CCNB1/1098), CF594 conjugate, 0.1mg/mL
BNC941098-500 1x 500 µL

Cyclin B1 (CCNB1/1098), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 / HCAM Std. (HCAM/2875R), CF594 conjugate, 0.1mg/mL
BNC942875-100 1x 100 µL

CD44 / HCAM Std. (HCAM/2875R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details