Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Gln9) -Amyloid b-Protein (1-40) trifluoroacetate salt

Product Specifications

CAS Number

1802084-59-8

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe- Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH; H-DAEFRHDSQYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH

MDL Number

MFCD09039220

Molecular Formula

C197H300N54O59S

Molecular Weight

4,400.88 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-500 1x 500 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-100 1x 100 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-500 1x 500 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF647 conjugate, 0.1mg/mL
BNC470487-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), CF740 conjugate, 0.1mg/mL
BNC742871-500 1x 500 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details