Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gastric Inhibitory Polypeptide (1-30) amide (porcine)

Product Specifications

CAS Number

134846-93-8

Synonyms

H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln- Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2; H-YA EGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2

MDL Number

MFCD00163742

Smiles

CCC (C) C (C (=O) NC (CCCNC (=N) N) C (=O) NC (CCC (=O) N) C (=O) NC (CCC (=O) N) C (=O) NC (CC (=O) O) C (=O) NC (CC1=CC=CC=C1) C (=O) NC (C (C) C) C (=O) NC (CC (=O) N) C (=O) NC (CC2=CNC3=CC=CC=C32) C (=O) NC (CC (C) C) C (=O) NC (CC (C) C) C (=O) NC (C) C (=O) NC (CCC (=O) N) C (=O) NC (CCCCN) C (=O) N) NC (=O) C (CCCCN) NC (=O) C (CC (=O) O) NC (=O) C (CCSC) NC (=O) C (C) NC (=O) C (C (C) CC) NC (=O) C (CO) NC (=O) C (CC4=CC=C (C=C4) O) NC (=O) C (CC (=O) O) NC (=O) C (CO) NC (=O) C (C (C) CC) NC (=O) C (CC5=CC=CC=C5) NC (=O) C (C (C) O) NC (=O) CNC (=O) C (CCC (=O) O) NC (=O) C (C) NC (=O) C (CC6=CC=C (C=C6) O) N

Molecular Formula

C162H245N41O47S

Molecular Weight

3,550.99 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
BNC880965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin-A (NAPSA/1239), CF647 conjugate, 0.1mg/mL
BNC471239-500 1x 500 µL

Napsin-A (NAPSA/1239), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (DCS-60.2), CF488A conjugate, 0.1mg/mL
BNC880822-500 1x 500 µL

P21 / WAF1 (DCS-60.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/1748), CF568 conjugate, 0.1mg/mL
BNC681748-500 1x 500 µL

Ubiquitin (Autophagy Marker) (UBB/1748), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details