What is the catalog number for GRF (ovine, caprine) trifluoroacetate salt?

The catalog number for GRF (ovine, caprine) trifluoroacetate salt is FG108887.

What sizes are available for GRF (ovine, caprine) trifluoroacetate salt?

GRF (ovine, caprine) trifluoroacetate salt is available in the following size(s): 1000 µg, 2000 µg, 5000 μg.

How many pack sizes does GRF (ovine, caprine) trifluoroacetate salt come in?

GRF (ovine, caprine) trifluoroacetate salt is available in 3 different pack sizes.

Is GRF (ovine, caprine) trifluoroacetate salt in stock?

GRF (ovine, caprine) trifluoroacetate salt is currently made to order / not held in immediate stock. Contact us for lead time.

GRF (ovine, caprine) trifluoroacetate salt

Product Specifications

CAS Number

94948-82-0

Synonyms

H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu -Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-G lu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Molecular Formula

C221H368N72O66S

Molecular Weight

5,121.8 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECP7825-1 96 Tests

Cyanocobalamin ELISA Kit

Sign In for Pricing

View Details

abx508008 96 Tests

Human Coatomer subunit zeta-2 (COPZ2) ELISA Kit

Sign In for Pricing

View Details

NBP2-59364F 100 µL

Mouse Monoclonal Citrulline Antibody (2D3.1) [FITC]

Sign In for Pricing

View Details

ORF028624 1.0 µg DNA

RAB11FIP3 ORF Vector (Human) (pORF)

Sign In for Pricing

View Details

MBS7023402-01 0.02 mg

Recombinant Nodulation protein J (nodJ)

Sign In for Pricing

View Details

MBS7023402-02 0.1 mg

Recombinant Nodulation protein J (nodJ)

Sign In for Pricing

View Details