Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRF (ovine, caprine) trifluoroacetate salt

Product Specifications

CAS Number

94948-82-0

Synonyms

H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu -Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-G lu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Molecular Formula

C221H368N72O66S

Molecular Weight

5,121.8 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR74 Lentiviral Activation Particles (h2)
sc-412316-LAC-2 200 µL

WDR74 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Toll Like Receptor 3 (TLR3)
TRV-0009412-01 10 µg

Recombinant Toll Like Receptor 3 (TLR3)

Sign In for Pricing
View Details
Recombinant Toll Like Receptor 3 (TLR3)
TRV-0009412-02 50 µg

Recombinant Toll Like Receptor 3 (TLR3)

Sign In for Pricing
View Details
Recombinant Toll Like Receptor 3 (TLR3)
TRV-0009412-03 100 µg

Recombinant Toll Like Receptor 3 (TLR3)

Sign In for Pricing
View Details
Recombinant Toll Like Receptor 3 (TLR3)
TRV-0009412-04 200 µg

Recombinant Toll Like Receptor 3 (TLR3)

Sign In for Pricing
View Details
Recombinant Toll Like Receptor 3 (TLR3)
TRV-0009412-05 500 µg

Recombinant Toll Like Receptor 3 (TLR3)

Sign In for Pricing
View Details