What is the catalog number for GRF (bovine) trifluoroacetate salt?

The catalog number for GRF (bovine) trifluoroacetate salt is FG108886.

What sizes are available for GRF (bovine) trifluoroacetate salt?

GRF (bovine) trifluoroacetate salt is available in the following size(s): 1000 µg, 2000 µg, 5000 μg.

How many pack sizes does GRF (bovine) trifluoroacetate salt come in?

GRF (bovine) trifluoroacetate salt is available in 3 different pack sizes.

Is GRF (bovine) trifluoroacetate salt in stock?

GRF (bovine) trifluoroacetate salt is currently made to order / not held in immediate stock. Contact us for lead time.

GRF (bovine) trifluoroacetate salt

Product Specifications

CAS Number

88894-91-1

Synonyms

H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln -Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-G lu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Molecular Formula

C220H366N72O66S

Molecular Weight

5,107.77 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-539099 1 Kit

MAP-1B (AA6) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing

View Details

K6959103 1.0 µg DNA

Tmf1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing

View Details

A15468-100UL 100 µL

C7 Antibody

Sign In for Pricing

View Details

50785114 3x 1.0 µg

Zdhhc16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing

View Details

orb2908577-01 20 µg

Recombinant Arabidopsis thaliana ABC transporter G family member 26 (ABCG26)

Sign In for Pricing

View Details

orb2908577-02 100 µg

Recombinant Arabidopsis thaliana ABC transporter G family member 26 (ABCG26)

Sign In for Pricing

View Details