Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRF (bovine) trifluoroacetate salt

Product Specifications

CAS Number

88894-91-1

Synonyms

H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln -Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-G lu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Molecular Formula

C220H366N72O66S

Molecular Weight

5,107.77 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf127 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0271706 1.0 µg DNA

C9orf127 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TRMT9B (NM_020844) Human Recombinant Protein
E45H31883E1 50 µg

TRMT9B (NM_020844) Human Recombinant Protein

Sign In for Pricing
View Details
DMRTA2 Human Over-expression Lysate
orb1351444 100 µg

DMRTA2 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana 17.4 kDa class I heat shock protein (HSP17.4A)
MBS1191418-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana 17.4 kDa class I heat shock protein (HSP17.4A)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana 17.4 kDa class I heat shock protein (HSP17.4A)
MBS1191418-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana 17.4 kDa class I heat shock protein (HSP17.4A)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana 17.4 kDa class I heat shock protein (HSP17.4A)
MBS1191418-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana 17.4 kDa class I heat shock protein (HSP17.4A)

Sign In for Pricing
View Details