What is the catalog number for GRF (bovine) trifluoroacetate salt?

The catalog number for GRF (bovine) trifluoroacetate salt is FG108886.

What sizes are available for GRF (bovine) trifluoroacetate salt?

GRF (bovine) trifluoroacetate salt is available in the following size(s): 1000 µg, 2000 µg, 5000 μg.

How many pack sizes does GRF (bovine) trifluoroacetate salt come in?

GRF (bovine) trifluoroacetate salt is available in 3 different pack sizes.

Is GRF (bovine) trifluoroacetate salt in stock?

GRF (bovine) trifluoroacetate salt is currently made to order / not held in immediate stock. Contact us for lead time.

GRF (bovine) trifluoroacetate salt

Product Specifications

CAS Number

88894-91-1

Synonyms

H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln -Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-G lu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Molecular Formula

C220H366N72O66S

Molecular Weight

5,107.77 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLR-AMY2-Hu-48T 48 Tests

Human Amylase Alpha 2, Pancreatic (AMY2) ELISA Kit

Sign In for Pricing

View Details

TRV-0039171-01 20 µL

Polyclonal Antibody to Nitric Oxide Synthase 1, Neuronal (NOS1)

Sign In for Pricing

View Details

TRV-0039171-02 100 µL

Polyclonal Antibody to Nitric Oxide Synthase 1, Neuronal (NOS1)

Sign In for Pricing

View Details

TRV-0039171-03 200 µL

Polyclonal Antibody to Nitric Oxide Synthase 1, Neuronal (NOS1)

Sign In for Pricing

View Details

TRV-0039171-04 1 mL

Polyclonal Antibody to Nitric Oxide Synthase 1, Neuronal (NOS1)

Sign In for Pricing

View Details

NBP1-76739AF700 0.1 mL

Rabbit Polyclonal IL-21R Antibody [Alexa Fluor 700]

Sign In for Pricing

View Details