Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation Factor XIIIa (190-230)

Product Specifications

CAS Number

158455-48-2

Synonyms

H-Asp-Asp-Ala-Val-Tyr-Leu-Asp-Asn-Glu-Lys-Glu-Arg-Glu-Glu-Tyr-Val-Leu-Asn-Asp-Ile-Gly-Val-Ile-Phe -Tyr-Gly-Glu-Val-Asn-Asp-Ile-Lys-T hr-Arg-Ser-Trp-Ser-Tyr-Gly-Gln-Phe-OH; H-DDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQF-OH

MDL Number

MFCD00676750

Smiles

Cn1c2c (c (=O) n (c1=O) C) n (c (n2) N[C@@H]3CCC[C@H]3O) Cc4ccccc4

Molecular Formula

C220H322N54O73

Molecular Weight

4,891.23 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXYD1 (NM_021902) Human Tagged ORF Clone
RG211575 10 µg

FXYD1 (NM_021902) Human Tagged ORF Clone

Sign In for Pricing
View Details
Pipette
E3086 1 Unit

Pipette

Sign In for Pricing
View Details
E3 SUMO protein ligase PIAS4 (PIAS4) (NM_015897) Human Tagged Lenti ORF Clone
RC206748L3 10 µg

E3 SUMO protein ligase PIAS4 (PIAS4) (NM_015897) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal Azurocidin/CAP37/HBP Antibody (308) [mFluor Violet 450 SE]
NBP2-89593MFV450 0.1 mL

Rabbit Monoclonal Azurocidin/CAP37/HBP Antibody (308) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
DFNA5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0586405 3x 1.0 µg

DFNA5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Flagellar P-ring protein (flgI)
MBS1230965-01 0.02 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Flagellar P-ring protein (flgI)

Sign In for Pricing
View Details