Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation Factor XIIIa (190-230)

Product Specifications

CAS Number

158455-48-2

Synonyms

H-Asp-Asp-Ala-Val-Tyr-Leu-Asp-Asn-Glu-Lys-Glu-Arg-Glu-Glu-Tyr-Val-Leu-Asn-Asp-Ile-Gly-Val-Ile-Phe -Tyr-Gly-Glu-Val-Asn-Asp-Ile-Lys-T hr-Arg-Ser-Trp-Ser-Tyr-Gly-Gln-Phe-OH; H-DDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQF-OH

MDL Number

MFCD00676750

Smiles

Cn1c2c (c (=O) n (c1=O) C) n (c (n2) N[C@@H]3CCC[C@H]3O) Cc4ccccc4

Molecular Formula

C220H322N54O73

Molecular Weight

4,891.23 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LXR alpha Rabbit mAb
RDSA67374 100 µL

LXR alpha Rabbit mAb

Sign In for Pricing
View Details
Recombinant Human CASP2 Protein, N-His
orb2968551-01 50 µg

Recombinant Human CASP2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CASP2 Protein, N-His
orb2968551-02 100 µg

Recombinant Human CASP2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CASP2 Protein, N-His
orb2968551-03 1 mg

Recombinant Human CASP2 Protein, N-His

Sign In for Pricing
View Details
Cdc25b ORF Vector (Rat) (pORF)
15603016 1.0 µg DNA

Cdc25b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human RYK qPCR Primer Pair
QH22121S 200 Tests

Human RYK qPCR Primer Pair

Sign In for Pricing
View Details