Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation Factor XIIIa (190-230)

Product Specifications

CAS Number

158455-48-2

Synonyms

H-Asp-Asp-Ala-Val-Tyr-Leu-Asp-Asn-Glu-Lys-Glu-Arg-Glu-Glu-Tyr-Val-Leu-Asn-Asp-Ile-Gly-Val-Ile-Phe -Tyr-Gly-Glu-Val-Asn-Asp-Ile-Lys-T hr-Arg-Ser-Trp-Ser-Tyr-Gly-Gln-Phe-OH; H-DDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQF-OH

MDL Number

MFCD00676750

Smiles

Cn1c2c (c (=O) n (c1=O) C) n (c (n2) N[C@@H]3CCC[C@H]3O) Cc4ccccc4

Molecular Formula

C220H322N54O73

Molecular Weight

4,891.23 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL10P16 sgRNA CRISPR Lentivector (Human) (Target 2)
K1900803 1.0 µg DNA

RPL10P16 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Cpg1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7407603 1.0 µg DNA

Cpg1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Klk1b8 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
25829124 3x 1.0µg DNA

Klk1b8 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
RBM17 Rabbit Polyclonal Antibody
E10G02704 100 µL

RBM17 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dystrobrevin alpha (DTNA) (NM_001391) Human Tagged Lenti ORF Clone
RC215398L3 10 µg

Dystrobrevin alpha (DTNA) (NM_001391) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Zfp229 Double Nickase Plasmid (m2)
sc-436236-NIC-2 20 µg

Zfp229 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details