Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Virus

IL-10 Protein critically masks infected cells for immune evasion by down-regulating the host TAP1 gene, hindering peptide transport into the endoplasmic reticulum and loading onto MHC class I molecules. IL-10 also inhibits IFN-gamma synthesis and exists as a homodimer. IL-10 Protein, Virus is the recombinant Virus-derived IL-10 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Virus, Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-virus.html

Purity

97.00

Smiles

QCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR

Molecular Formula

2949786 (Gene_ID) P03180 (Q26-R170) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEX22 (NM_001195082) Human Over-expression Lysate
LY433992 100 µg

TEX22 (NM_001195082) Human Over-expression Lysate

Sign In for Pricing
View Details
BAX Rabbit Polyclonal Antibody
AP21052PU-N 100 µg

BAX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD10 Antibody[HI10a]
E-AB-F1141L-01 20 Tests

Elab Fluor® 488 Anti-Human CD10 Antibody[HI10a]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD10 Antibody[HI10a]
E-AB-F1141L-02 100 Tests

Elab Fluor® 488 Anti-Human CD10 Antibody[HI10a]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD10 Antibody[HI10a]
E-AB-F1141L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD10 Antibody[HI10a]

Sign In for Pricing
View Details
PTPRK Polyclonal Antibody
E-AB-90949-01 60 µL

PTPRK Polyclonal Antibody

Sign In for Pricing
View Details