Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Virus

IL-10 Protein critically masks infected cells for immune evasion by down-regulating the host TAP1 gene, hindering peptide transport into the endoplasmic reticulum and loading onto MHC class I molecules. IL-10 also inhibits IFN-gamma synthesis and exists as a homodimer. IL-10 Protein, Virus is the recombinant Virus-derived IL-10 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Virus, Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-virus.html

Purity

97.00

Smiles

QCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR

Molecular Formula

2949786 (Gene_ID) P03180 (Q26-R170) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), CF568 conjugate, 0.1mg/mL
BNC681863-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Fluorobiphenyl-4-carboxylic Acid
TRC-F588760-1G 1 g

2-Fluorobiphenyl-4-carboxylic Acid

Sign In for Pricing
View Details
ASS1 Recombinant Mouse monoclonal Antibody
HA610025 100 µg

ASS1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
IL17F Human
OM296468-01 25 µg

IL17F Human

Sign In for Pricing
View Details
IL17F Human
OM296468-02 5 µg

IL17F Human

Sign In for Pricing
View Details
IL17F Human
OM296468-03 1 mg

IL17F Human

Sign In for Pricing
View Details