Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Virus

IL-10 Protein critically masks infected cells for immune evasion by down-regulating the host TAP1 gene, hindering peptide transport into the endoplasmic reticulum and loading onto MHC class I molecules. IL-10 also inhibits IFN-gamma synthesis and exists as a homodimer. IL-10 Protein, Virus is the recombinant Virus-derived IL-10 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Virus, Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-virus.html

Purity

97.00

Smiles

QCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR

Molecular Formula

2949786 (Gene_ID) P03180 (Q26-R170) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem42 Mouse Gene Knockout Kit (CRISPR)
KN517864 1 Kit

Tmem42 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lif Mouse Gene Knockout Kit (CRISPR)
KN309278BN 1 Kit

Lif Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS715000 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Butyric-4,4,4-d3 Acid
TRC-B692241-10MG 10 mg

Butyric-4,4,4-d3 Acid

Sign In for Pricing
View Details
MRPS11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C1]
TA802862BM 100 µL

MRPS11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C1]

Sign In for Pricing
View Details
Dehydro Butamirate (E/Z-Mixture)
TRC-D357375-50MG 50 mg

Dehydro Butamirate (E/Z-Mixture)

Sign In for Pricing
View Details