IL-10, Virus
IL-10 Protein critically masks infected cells for immune evasion by down-regulating the host TAP1 gene, hindering peptide transport into the endoplasmic reticulum and loading onto MHC class I molecules. IL-10 also inhibits IFN-gamma synthesis and exists as a homodimer. IL-10 Protein, Virus is the recombinant Virus-derived IL-10 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IL-10 Protein, Virus, Virus, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-10-protein-virus.html
Purity
97.00
Smiles
QCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR
Molecular Formula
2949786 (Gene_ID) P03180 (Q26-R170) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
MTHFD1L (aa535-538) (Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like, DKFZp586G1517, FLJ21145, FTHFSDC1, MTC1THFS, DJ292B18.2, 10-formyl-THF synthetase, Formyltetrahydrofolate synthetase domain containing 1) discontinued. see 215642
Cathepsin B Recombinant Antibody, APC Conjugated
Cathepsin B Recombinant Antibody, APC Conjugated
