Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt

Product Specifications

CAS Number

133551-97-0

Synonyms

H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2

Molecular Formula

C223H322N56O63S4

Molecular Weight

4,923.55 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF488A conjugate, 0.1mg/mL
BNC880821-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (OKT3), CF647 conjugate, 0.1mg/mL
BNC470268-500 1x 500 µL

CD3e (T-Cell Marker) (OKT3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (MYC275), CF647 conjugate, 0.1mg/mL
BNC470275-500 1x 500 µL

C-Myc (MYC275), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF568 conjugate, 0.1mg/mL
BNC682054-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details