Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCC-4/CCL16, Human (CHO)

HCC-4/CCL16 Protein, Human (CHO) is a CC chemokine that specifically attracts lymphocytes, dendritic cells and monocytes, increases their adhesion and has myelosuppressive activity. HCC-4/CCL16 Protein, Human (CHO) interacts with CCR1, CCR2, CCR5 and CCR8 to mediate inflammatory and cancer responses. HCC-4/CCL16 Protein, Human (CHO) is a recombinant human HCC-4/CCL16 (Q24-Q120) expressed by CHO[1].

Product Specifications

Product Name Alternative

HCC-4/CCL16 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hcc-4-ccl16-protein-human-cho.html

Purity

96.00

Smiles

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Molecular Formula

6360 (Gene_ID) O15467 (Q24-Q120) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[2]Jiahui Xu, et al. Silencing XIST mitigated lipopolysaccharide (LPS) -induced inflammatory injury in human lung fibroblast WI-38 cells through modulating miR-30b-5p/CCL16 axis and TLR4/NF-κB signaling pathway. Open Life Sci. 2021 Feb 6;16 (1) :108-127.|[3]In Sik Kim, et al. Differential CCR1-mediated chemotaxis signaling induced by human CC chemokine HCC-4/CCL16 in HOS cells. FEBS Lett. 2005 Nov 7;579 (27) :6044-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lymphoid tissue
CR561914 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
PARK7 Human Gene Knockout Kit (CRISPR)
KN201645LP 1 Kit

PARK7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SAMHD1 Human Gene Knockout Kit (CRISPR)
KN206013LP 1 Kit

SAMHD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Claudin 10 (CLDN10) (NM_006984) Human Over-expression Lysate
LC402070 20 µg

Claudin 10 (CLDN10) (NM_006984) Human Over-expression Lysate

Sign In for Pricing
View Details
SHC (SHC1) (NM_003029) Human Recombinant Protein
TP304362 20 µg

SHC (SHC1) (NM_003029) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS628393 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details