Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glucagon (1-29) -[Lys (AF647) ]

Product Specifications

Synonyms

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (K/AF647 DBCO) -NH2; HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Lys (AF647 DBCO) ]-amide; H-His-Ser-Gln-Gly-Thr-Phe-Th r-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala- Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-[Lys (AF647 DBCO) ]-NH2

Molecular Weight

4,750 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPG (NM_001015054) Human Over-expression Lysate
LY423120 100 µg

MPG (NM_001015054) Human Over-expression Lysate

Sign In for Pricing
View Details
Arvcf Mouse Gene Knockout Kit (CRISPR)
KN501637 1 Kit

Arvcf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Neurovascular bundle
CS807604 5x 5 µm

Tissue FFPE Sections, Neurovascular bundle

Sign In for Pricing
View Details
Myosin IIIB (MYO3B) (NM_001083615) Human Over-expression Lysate
LC421238 20 µg

Myosin IIIB (MYO3B) (NM_001083615) Human Over-expression Lysate

Sign In for Pricing
View Details
PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI17F7]
CF807988 100 µg

PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI17F7]

Sign In for Pricing
View Details
Tissue Protein Lysate, Skin
CP609070 150 µg

Tissue Protein Lysate, Skin

Sign In for Pricing
View Details