Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glucagon (1-29) -[Lys (AF647) ]

Product Specifications

Synonyms

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (K/AF647 DBCO) -NH2; HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Lys (AF647 DBCO) ]-amide; H-His-Ser-Gln-Gly-Thr-Phe-Th r-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala- Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-[Lys (AF647 DBCO) ]-NH2

Molecular Weight

4,750 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arprinocid
TRC-A735500-50MG 50 mg

Arprinocid

Sign In for Pricing
View Details
8-Channel manifold
MW9600-8CM 1 Each

8-Channel manifold

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 alpha (CCL20) (33-44) Goat Polyclonal Antibody
AP31430PU-N 50 µg

Macrophage Inflammatory Protein 3 alpha (CCL20) (33-44) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl Paraben-d4
TRC-E925478-25MG 25 mg

Ethyl Paraben-d4

Sign In for Pricing
View Details
MAGEB1 (NM_177404) Human Recombinant Protein
TP324906M 100 µg

MAGEB1 (NM_177404) Human Recombinant Protein

Sign In for Pricing
View Details
(2RS,4R,8R)-Delta-Tocopherol-d4 (Mixture of Diastereomers)
TRC-T526152-1MG 1 mg

(2RS,4R,8R)-Delta-Tocopherol-d4 (Mixture of Diastereomers)

Sign In for Pricing
View Details