Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glucagon (1-29) -[Lys (AF647) ]

Product Specifications

Synonyms

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (K/AF647 DBCO) -NH2; HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Lys (AF647 DBCO) ]-amide; H-His-Ser-Gln-Gly-Thr-Phe-Th r-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala- Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-[Lys (AF647 DBCO) ]-NH2

Molecular Weight

4,750 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL8B (NM_018184) Human Over-expression Lysate
LC402654 20 µg

ARL8B (NM_018184) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Frrs1 activation kit by CRISPRa
GA203820 1 Kit

Mouse Frrs1 activation kit by CRISPRa

Sign In for Pricing
View Details
Bromazine Hydrochloride
TRC-B678525-25MG 25 mg

Bromazine Hydrochloride

Sign In for Pricing
View Details
UGT8 Rabbit Polyclonal Antibody
AP05205PU-N 100 µg

UGT8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CYP20A1 (Center) Rabbit Polyclonal Antibody
AP51165PU-N 400 µL

CYP20A1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PATE (PATE1) activation kit by CRISPRa
GA115994 1 Kit

Human PATE (PATE1) activation kit by CRISPRa

Sign In for Pricing
View Details