Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin-4 [Lys (AF647) ]

Product Specifications

Synonyms

H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (K/AF647 DBCO) -NH2; HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-[K (AF647 DBCO) ]-amide; H-His-Gly- Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu- Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-S

Molecular Weight

5,454.4 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(10-Aminodecyl)-5-chloro-1-naphthalenesulfonamide Hydrochloride
TRC-A603750-5MG 5 mg

N-(10-Aminodecyl)-5-chloro-1-naphthalenesulfonamide Hydrochloride

Sign In for Pricing
View Details
GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI2D12]
CF810248 100 µg

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI2D12]

Sign In for Pricing
View Details
RAB12 Rabbit Polyclonal Antibody
TA380608 100 µL

RAB12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (MACIF/1193), 1mg/mL
BNUM1193-50 1x 50 µL

CD59 (heavy chain of Protectin) (MACIF/1193), 1mg/mL

Sign In for Pricing
View Details
Benzyl 2,4-Dibromobutyrate-d5
TRC-B279212-25MG 25 mg

Benzyl 2,4-Dibromobutyrate-d5

Sign In for Pricing
View Details
FGD5 (NM_152536) Human Over-expression Lysate
LY432449 100 µg

FGD5 (NM_152536) Human Over-expression Lysate

Sign In for Pricing
View Details