Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin-4 [Lys (AF647) ]

Product Specifications

Synonyms

H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (K/AF647 DBCO) -NH2; HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-[K (AF647 DBCO) ]-amide; H-His-Gly- Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu- Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-S

Molecular Weight

5,454.4 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SESN3 (Center) Rabbit Polyclonal Antibody
AP53867PU-N 400 µL

SESN3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung: right upper lobe
CR560308 5 µg

Tissue Total RNA, Lung: right upper lobe

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF594 conjugate, 0.1mg/mL
BNC942221-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDCA3 (C-term) Rabbit Polyclonal Antibody
AP32284PU-N 50 µL

CDCA3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-(Aminoethyl)-8-naphthylamine-1-sulfonic Acid
TRC-A609400-2G 2 g

N-(Aminoethyl)-8-naphthylamine-1-sulfonic Acid

Sign In for Pricing
View Details
Medium Water Purification System BDPS-401
BDPS-401 1 Unit

Medium Water Purification System BDPS-401

Sign In for Pricing
View Details