Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP-1 (7-36) [Cys (Sulfocyanine5) ]

Product Specifications

Synonyms

H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (C/Sulfocyanine5) -NH2; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys (Sulfocyanine5) ]-amide; H-His-Ala-Glu-Gly-Th r-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala- Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-[Cys (Sulfocyanine5)

Molecular Weight

4,162.9 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REG3A (NM_138937) Human Recombinant Protein
TP316966M 100 µg

REG3A (NM_138937) Human Recombinant Protein

Sign In for Pricing
View Details
BCL2 (1-211) Mouse Monoclonal Antibody [Clone ID: AT1B5]
AM09378PU-S 50 µL

BCL2 (1-211) Mouse Monoclonal Antibody [Clone ID: AT1B5]

Sign In for Pricing
View Details
Human GNPTAB activation kit by CRISPRa
GA112393 1 Kit

Human GNPTAB activation kit by CRISPRa

Sign In for Pricing
View Details
Thyroid Hormone Receptor alpha (THRA) (NM_003250) Human Over-expression Lysate
LY418803 100 µg

Thyroid Hormone Receptor alpha (THRA) (NM_003250) Human Over-expression Lysate

Sign In for Pricing
View Details
Factor H (CFH) Mouse Monoclonal Antibody [Clone ID: OX-24]
AM20110PU-N 50 µg

Factor H (CFH) Mouse Monoclonal Antibody [Clone ID: OX-24]

Sign In for Pricing
View Details
5-Bromo-3-nitro-2(1H)-pyridinone
TRC-B686265-500MG 500 mg

5-Bromo-3-nitro-2(1H)-pyridinone

Sign In for Pricing
View Details