Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP-1 (7-36) [Cys (Sulfocyanine5) ]

Product Specifications

Synonyms

H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (C/Sulfocyanine5) -NH2; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys (Sulfocyanine5) ]-amide; H-His-Ala-Glu-Gly-Th r-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala- Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-[Cys (Sulfocyanine5)

Molecular Weight

4,162.9 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N2-Benzyloxycarbonyl-L-ornithine
TRC-B285908-10G 10 g

N2-Benzyloxycarbonyl-L-ornithine

Sign In for Pricing
View Details
EFCAB1-set siRNA/shRNA/RNAi Lentivector (Human)
18991091 4x 500 ng

EFCAB1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Cd90 (T25, Theta antigen, Thy-1 antigen , Thy-1 membrane glycoprotein, Thy1 T cell antigen, Thy1.1, Thy1.2) (BSA & Azide Free) (MaxLight 750) discontinued
168729-AF-ML750 100 µL

Cd90 (T25, Theta antigen, Thy-1 antigen , Thy-1 membrane glycoprotein, Thy1 T cell antigen, Thy1.1, Thy1.2) (BSA & Azide Free) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PGK1 Rabbit mAb Antibody
orb3015012 100 µL

PGK1 Rabbit mAb Antibody

Sign In for Pricing
View Details
Mouse Monoclonal NULP1 Antibody (PCRP-TCF25-1F12) [Alexa Fluor 750]
NBP3-08354AF750 100 µL

Mouse Monoclonal NULP1 Antibody (PCRP-TCF25-1F12) [Alexa Fluor 750]

Sign In for Pricing
View Details
RGS18 Protein Lysate
OCOA06722-20UG 20 µg

RGS18 Protein Lysate

Sign In for Pricing
View Details