Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gp96-II

Product Specifications

Synonyms

H-LNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY-OH; LNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY-acid; H-Leu-Asn-Val-Ser-Arg-Glu-Thr-Leu-Gln-Gln-His- Lys-Leu-Leu-Lys-Val-Ile-Arg-Lys-Lys-Leu-Va l-Arg-Lys-Thr-Leu-Asp-Met-Ile-Lys-Lys-Ile-Ala-Asp-Asp-Lys-Tyr-OH

Molecular Weight

4,461.6 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluor568-conjugated Polyclonal Goat Anti-Rabbit IgG (H+L) Secondary Antibody
APS0121-01 200 µL

Fluor568-conjugated Polyclonal Goat Anti-Rabbit IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
Fluor568-conjugated Polyclonal Goat Anti-Rabbit IgG (H+L) Secondary Antibody
APS0121-02 500 µL

Fluor568-conjugated Polyclonal Goat Anti-Rabbit IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
Anti-PCSK9 Antibody Picoband®, Carrier-free
PA2130-carrier-free 100 µg/Vial

Anti-PCSK9 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
LRRC10 Rabbit pAb, AP conjugated
orb2886431 100 µL

LRRC10 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Rat Slc1a6 Pre-designed siRNA Set A
SI212987A 1 Each

Rat Slc1a6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Zebrafish vwf Antibody
MBS1755948-01 0.2 mL

Anti-Zebrafish vwf Antibody

Sign In for Pricing
View Details