Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37 amide

Product Specifications

CAS Number

597562-32-8

Synonyms

H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2; LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-amide; H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Gl u-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gl n-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2

Molecular Formula

C205H341N61O52

Molecular Weight

4,493.3 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINE2 Peptide
DF7278-BP 1 mg

SERPINE2 Peptide

Sign In for Pricing
View Details
Human FAHD2B Protein Lysate
MBS8411360-01 0.02 mg

Human FAHD2B Protein Lysate

Sign In for Pricing
View Details
Human FAHD2B Protein Lysate
MBS8411360-02 5x 0.02 mg

Human FAHD2B Protein Lysate

Sign In for Pricing
View Details
CLEC2A 3'UTR GFP Stable Cell Line
TU054546 1.0 mL

CLEC2A 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-PENK Antibody
MBS4505071-01 0.05 mL

Rabbit anti-PENK Antibody

Sign In for Pricing
View Details
Rabbit anti-PENK Antibody
MBS4505071-02 0.1 mL

Rabbit anti-PENK Antibody

Sign In for Pricing
View Details