Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37 amide

Product Specifications

CAS Number

597562-32-8

Synonyms

H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2; LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-amide; H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Gl u-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gl n-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2

Molecular Formula

C205H341N61O52

Molecular Weight

4,493.3 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRMP5 Rabbit Polyclonal Antibody (Cy5)
orb879920 100 µL

CRMP5 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
TCR antibody (allophycocyanin)
61R-1775 0.025 mg

TCR antibody (allophycocyanin)

Sign In for Pricing
View Details
Rabbit anti-human 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) polyclonal Antibody
MBS714293-01 0.1 mL

Rabbit anti-human 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) polyclonal Antibody
MBS714293-02 5x 0.1 mL

Rabbit anti-human 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Putative serine protease K12H4.7 (K12H4.7)
MBS1192442-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Putative serine protease K12H4.7 (K12H4.7)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Putative serine protease K12H4.7 (K12H4.7)
MBS1192442-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Putative serine protease K12H4.7 (K12H4.7)

Sign In for Pricing
View Details