Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H3.3 (1-44)

Product Specifications

Synonyms

H-ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG-OH

Molecular Weight

4,684.7 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CALHM3 Knockout A549 cell line
GTR15404500 1 Vial

Human CALHM3 Knockout A549 cell line

Sign In for Pricing
View Details
Lentiviral human RNF14 shRNA (UAS) - Lentiviral human RNF14 shRNA (UAS, GFP) plasmid
GTR15100198 1 Vial

Lentiviral human RNF14 shRNA (UAS) - Lentiviral human RNF14 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CIB2 (CIB2C12B11)
sc-81068 100 µg/mL

CIB2 (CIB2C12B11)

Sign In for Pricing
View Details
Krueppel-Like Factor 13 (KLF13) Antibody (FITC)
abx336277-01 20 µg

Krueppel-Like Factor 13 (KLF13) Antibody (FITC)

Sign In for Pricing
View Details
Krueppel-Like Factor 13 (KLF13) Antibody (FITC)
abx336277-02 50 µg

Krueppel-Like Factor 13 (KLF13) Antibody (FITC)

Sign In for Pricing
View Details
Krueppel-Like Factor 13 (KLF13) Antibody (FITC)
abx336277-03 100 µg

Krueppel-Like Factor 13 (KLF13) Antibody (FITC)

Sign In for Pricing
View Details