Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H3.2 (1-44)

Product Specifications

Synonyms

H-ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG-OH

Molecular Weight

4,668.7 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Concisus lpxD Protein (aa 1-317)
VAng-Lsx5830-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Concisus lpxD Protein (aa 1-317)

Sign In for Pricing
View Details
FADD Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61661R-BF680-TR 20 µL

FADD Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Mouse Nuclear Receptor Subfamily 1 Group I Member 3 (NR1I3) ELISA Kit
abx255083-01 96 Tests

Mouse Nuclear Receptor Subfamily 1 Group I Member 3 (NR1I3) ELISA Kit

Sign In for Pricing
View Details
Mouse Nuclear Receptor Subfamily 1 Group I Member 3 (NR1I3) ELISA Kit
abx255083-02 5x 96 Tests

Mouse Nuclear Receptor Subfamily 1 Group I Member 3 (NR1I3) ELISA Kit

Sign In for Pricing
View Details
Mouse Nuclear Receptor Subfamily 1 Group I Member 3 (NR1I3) ELISA Kit
abx255083-03 10x 96 Tests

Mouse Nuclear Receptor Subfamily 1 Group I Member 3 (NR1I3) ELISA Kit

Sign In for Pricing
View Details
SRPX2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
45497064 1.0 µg DNA

SRPX2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details