Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (1-42) -[C] human

Product Specifications

Synonyms

H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQC-NH2

Molecular Weight

1,234.5 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-[2-(Ethylthio)propyl]-1,3-cyclohexanedione
TRC-E432250-500MG 500 mg

5-[2-(Ethylthio)propyl]-1,3-cyclohexanedione

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), CF568 conjugate, 0.1mg/mL
BNC683527-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6-Phenylphenathridine-3,8-diamine
TRC-P335860-500MG 500 mg

6-Phenylphenathridine-3,8-diamine

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD18 Antibody[60.3]
E-AB-F1412Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human CD18 Antibody[60.3]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD18 Antibody[60.3]
E-AB-F1412Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Human CD18 Antibody[60.3]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD18 Antibody[60.3]
E-AB-F1412Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Human CD18 Antibody[60.3]

Sign In for Pricing
View Details