Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (1-42) -[C] human

Product Specifications

Synonyms

H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQC-NH2

Molecular Weight

1,234.5 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keto Diclofenac Sodium Salt
TRC-K188000-50MG 50 mg

Keto Diclofenac Sodium Salt

Sign In for Pricing
View Details
Phospho-B Raf (T401) Recombinant Rabbit Monoclonal Antibody [JJ08-72]
ET1701-20 100 µL

Phospho-B Raf (T401) Recombinant Rabbit Monoclonal Antibody [JJ08-72]

Sign In for Pricing
View Details
TRAPPC3L (NM_001139444) Human Recombinant Protein
TP327688M 100 µg

TRAPPC3L (NM_001139444) Human Recombinant Protein

Sign In for Pricing
View Details
Resveratrol
SIH-264-100MG 100 mg

Resveratrol

Sign In for Pricing
View Details
Cytokeratin 7 (K72.7), CF488A conjugate, 0.1mg/mL
BNC880757-100 1x 100 µL

Cytokeratin 7 (K72.7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: OTI3C1]
CF805924 100 µg

Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: OTI3C1]

Sign In for Pricing
View Details