Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-42) Human

Product Specifications

CAS Number

107761-42-2

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH; Abeta 1-42

Molecular Weight

4,514.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NOB1 Antibody (OTI1C12) [Alexa Fluor 700]
NBP2-73027AF700 0.1 mL

Mouse Monoclonal NOB1 Antibody (OTI1C12) [Alexa Fluor 700]

Sign In for Pricing
View Details
MAP3K13 (LZK, Mitogen-activated Protein Kinase Kinase Kinase 13, Leucine Zipper-bearing Kinase, Mixed Lineage Kinase) (MaxLight 750) discontinued
129381-ML750 100 µL

MAP3K13 (LZK, Mitogen-activated Protein Kinase Kinase Kinase 13, Leucine Zipper-bearing Kinase, Mixed Lineage Kinase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SARS-CoV-2-IN-50
MBS5820890 Inquire

SARS-CoV-2-IN-50

Sign In for Pricing
View Details
M5-127-481 Pre-sized Label Cartridges for Printers
175660 360 Box (360 Label (s) x 1 Cassette)

M5-127-481 Pre-sized Label Cartridges for Printers

Sign In for Pricing
View Details
Human Monoclonal Integrin alpha L/CD11a Antibody (Hu103-2) [PE/Cy5.5]
FAB10350PECY55 0.1 mL

Human Monoclonal Integrin alpha L/CD11a Antibody (Hu103-2) [PE/Cy5.5]

Sign In for Pricing
View Details
Human Albumin antibody
MBS534012-01 1 mL

Human Albumin antibody

Sign In for Pricing
View Details