Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-42) Human

Product Specifications

CAS Number

107761-42-2

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH; Abeta 1-42

Molecular Weight

4,514.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CRABP1 Antibody [PE]
NBP3-00304PE 0.1 mL

Rabbit Polyclonal CRABP1 Antibody [PE]

Sign In for Pricing
View Details
SPC25 Antibody; HRP conjugated
MBS7003922-01 0.05 mg

SPC25 Antibody; HRP conjugated

Sign In for Pricing
View Details
SPC25 Antibody; HRP conjugated
MBS7003922-02 0.1 mg

SPC25 Antibody; HRP conjugated

Sign In for Pricing
View Details
SPC25 Antibody; HRP conjugated
MBS7003922-03 5x 0.1 mg

SPC25 Antibody; HRP conjugated

Sign In for Pricing
View Details
Eta Antibody
orb833751-01 50 μL

Eta Antibody

Sign In for Pricing
View Details
Eta Antibody
orb833751-02 100 µL

Eta Antibody

Sign In for Pricing
View Details