Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-42) Human

Product Specifications

CAS Number

107761-42-2

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH; Abeta 1-42

Molecular Weight

4,514.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Substance P Antibody (SR2325)
NBP3-27852-100ul 100 µL

Rabbit Monoclonal Substance P Antibody (SR2325)

Sign In for Pricing
View Details
Rat Recombinant anti-Mouse CD192 (CCR2) Recombinant Antibody
xAP-0564 100 µg

Rat Recombinant anti-Mouse CD192 (CCR2) Recombinant Antibody

Sign In for Pricing
View Details
EIF2B1 Adenovirus (Rat)
19082056 1.0 mL

EIF2B1 Adenovirus (Rat)

Sign In for Pricing
View Details
OR2A14 CRISPR Knock Out 293T Cell Line (Human)
35025141 1x 10^6 Cells / 1.0 mL

OR2A14 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
IREB2 Blocking Peptide
MBS9632107-01 1 mg

IREB2 Blocking Peptide

Sign In for Pricing
View Details
IREB2 Blocking Peptide
MBS9632107-02 5x 1 mg

IREB2 Blocking Peptide

Sign In for Pricing
View Details