Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-42) Human

Product Specifications

CAS Number

107761-42-2

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH; Abeta 1-42

Molecular Weight

4,514.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA-R-Spondin1-Fc 293T Cells
ABC-RC0139 1 Vial

HA-R-Spondin1-Fc 293T Cells

Sign In for Pricing
View Details
Mir877 Mouse MicroRNA Expression Plasmid (MI0005553)
SC401235 10 µg

Mir877 Mouse MicroRNA Expression Plasmid (MI0005553)

Sign In for Pricing
View Details
Mouse Monoclonal HGF Antibody (OTI1D2) [PerCP]
NBP2-70884PCP 0.1 mL

Mouse Monoclonal HGF Antibody (OTI1D2) [PerCP]

Sign In for Pricing
View Details
Human RPS16 siRNA
abx904692-01 15 nmol

Human RPS16 siRNA

Sign In for Pricing
View Details
Human RPS16 siRNA
abx904692-02 30 nmol

Human RPS16 siRNA

Sign In for Pricing
View Details
TktA Recombinant Protein
OPCA02080-20UG 20 µg

TktA Recombinant Protein

Sign In for Pricing
View Details