Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-40) Human

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH; Abeta 1-40

Molecular Weight

4,329.8 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl Daclatasvir
TRC-A172160-25MG 25 mg

N-Acetyl Daclatasvir

Sign In for Pricing
View Details
GFP-Null fusion control lentiviral particles
Null-G 1 x 10^7 IFU/mL - 200 µL

GFP-Null fusion control lentiviral particles

Sign In for Pricing
View Details
ACMSD Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
11176064 1.0 µg DNA

ACMSD Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Timeless 3'UTR Luciferase Stable Cell Line
TU221891 1.0 mL

Timeless 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Chemokine C-C-Motif Ligand 1 (CCL1) ELISA Kit
JL42145-01 48 Tests

Mouse Chemokine C-C-Motif Ligand 1 (CCL1) ELISA Kit

Sign In for Pricing
View Details
Mouse Chemokine C-C-Motif Ligand 1 (CCL1) ELISA Kit
JL42145-02 96 Tests

Mouse Chemokine C-C-Motif Ligand 1 (CCL1) ELISA Kit

Sign In for Pricing
View Details