Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-40) Human

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH; Abeta 1-40

Molecular Weight

4,329.8 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Protein RFT1 Homolog (RFT1) ELISA Kit
MBS9939679 Inquire

Fish Protein RFT1 Homolog (RFT1) ELISA Kit

Sign In for Pricing
View Details
Exo-cis-lurasidone hydrochloride
PFA56325-01 5 mg

Exo-cis-lurasidone hydrochloride

Sign In for Pricing
View Details
Exo-cis-lurasidone hydrochloride
PFA56325-02 10 mg

Exo-cis-lurasidone hydrochloride

Sign In for Pricing
View Details
Exo-cis-lurasidone hydrochloride
PFA56325-03 25 mg

Exo-cis-lurasidone hydrochloride

Sign In for Pricing
View Details
Exo-cis-lurasidone hydrochloride
PFA56325-04 50 mg

Exo-cis-lurasidone hydrochloride

Sign In for Pricing
View Details
OR4A15 Antibody
CSB-PA003545-01 50 µg

OR4A15 Antibody

Sign In for Pricing
View Details