Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-40) Human

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH; Abeta 1-40

Molecular Weight

4,329.8 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF321 Protein Lysate
MBS8430223-01 0.02 mg

Human ZNF321 Protein Lysate

Sign In for Pricing
View Details
Human ZNF321 Protein Lysate
MBS8430223-02 5x 0.02 mg

Human ZNF321 Protein Lysate

Sign In for Pricing
View Details
Zic3 shRNA (h) Lentiviral Particles
sc-106711-V 200 µL

Zic3 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
COL6A6 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
16596065 1.0 µg DNA

COL6A6 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human MRGPRX1 Pre-designed siRNA Set B
SI009789B 1 Each

Human MRGPRX1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
FSTL1 Antibody
A40613-50UL 50 μL

FSTL1 Antibody

Sign In for Pricing
View Details