Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-40) Human

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH; Abeta 1-40

Molecular Weight

4,329.8 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Polyclonal BromoTag Antibody [HRP]
NBP3-17999H 0.1 mL

Sheep Polyclonal BromoTag Antibody [HRP]

Sign In for Pricing
View Details
TMSB15A 3'UTR Luciferase Stable Cell Line
TU025983 1.0 mL

TMSB15A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Complement Component 4a (C4a) ELISA Kit
MBS453993-01 48 Tests

Mouse Complement Component 4a (C4a) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Component 4a (C4a) ELISA Kit
MBS453993-02 96 Tests

Mouse Complement Component 4a (C4a) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Component 4a (C4a) ELISA Kit
MBS453993-03 5x 96 Tests

Mouse Complement Component 4a (C4a) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Component 4a (C4a) ELISA Kit
MBS453993-04 10x 96 Tests

Mouse Complement Component 4a (C4a) ELISA Kit

Sign In for Pricing
View Details