Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Amyloid (1-40) Human

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH; Abeta 1-40

Molecular Weight

4,329.8 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FREM3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
20942154 3x 1.0 µg DNA

FREM3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
EdU Imaging Kits (DAB)
K2257-200 200 - 2000 Tests

EdU Imaging Kits (DAB)

Sign In for Pricing
View Details
ALAS1 (aminolevulinate, delta-, Synthase 1, ALAS, ALAS3, ALASH, MIG4) (MaxLight 405)
MBS6194457-01 0.1 mL

ALAS1 (aminolevulinate, delta-, Synthase 1, ALAS, ALAS3, ALASH, MIG4) (MaxLight 405)

Sign In for Pricing
View Details
ALAS1 (aminolevulinate, delta-, Synthase 1, ALAS, ALAS3, ALASH, MIG4) (MaxLight 405)
MBS6194457-02 5x 0.1 mL

ALAS1 (aminolevulinate, delta-, Synthase 1, ALAS, ALAS3, ALASH, MIG4) (MaxLight 405)

Sign In for Pricing
View Details
SFRS7 Antibody
35076-01 50 µL

SFRS7 Antibody

Sign In for Pricing
View Details
SFRS7 Antibody
35076-02 100 µL

SFRS7 Antibody

Sign In for Pricing
View Details