Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)

Product Specifications

Product Name Alternative

Lymphotoxin-beta receptor; Tumor necrosis factor C receptor; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor type III

Abbreviation

Recombinant Human LTBR protein, partial (Active)

Gene Name

LTBR

UniProt

P36941

Expression Region

31-227aa

Organism

Homo sapiens (Human)

Target Sequence

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Tag

N-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Yeast

Field of Research

Cell Biology

Relevance

Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Activates NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA1-LTB2) . Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/mL can bind Anti-LTBR recombinant antibody (CSB-RA013227MA1HU), the EC50 is 0.5282-0.6120 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 7.283-8.859 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.2 kDa

References & Citations

Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CPXV CrmD Polyclonal Antibody
VK068014-01 50 µg

Anti-CPXV CrmD Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CPXV CrmD Polyclonal Antibody
VK068014-02 100 µg

Anti-CPXV CrmD Polyclonal Antibody

Sign In for Pricing
View Details
CRMP2 Mouse mAb
E47M51453 100 µL

CRMP2 Mouse mAb

Sign In for Pricing
View Details
LKAAEAR1 Human Gene Knockout Kit (CRISPR)
KN407838 1 Kit

LKAAEAR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dectrekumab Biosimilar - Research Grade
ICH5470-10mg 10 mg (2x 5 mg)

Dectrekumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Recombinant Acidovorax sp. Large-conductance mechanosensitive channel (mscL)
MBS7020969-01 0.02 mg

Recombinant Acidovorax sp. Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details