Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 25 protein (CCL25) (Active)

Product Specifications

Product Name Alternative

Chemokine TECK, Thymus-expressed chemokine

Abbreviation

Recombinant Human CCL25 protein (Active)

Gene Name

CCL25

UniProt

O15444

Expression Region

24-150aa

Organism

Homo sapiens (Human)

Target Sequence

M+QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL2BPP6 Protein Vector (Human) (pPB-His-GST)
PV323703 500 ng

ARL2BPP6 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Rabbit anti-SAALl Antibody, Affinity Purified
A304-966A 100 µg

Rabbit anti-SAALl Antibody, Affinity Purified

Sign In for Pricing
View Details
Aromatase (ARO) BioAssayTM ELISA Kit (Human)
023575 96 Tests

Aromatase (ARO) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Comtd1 Mouse Gene Knockout Kit (CRISPR)
KN503674 1 Kit

Comtd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lentiviral mouse Mrps15 shRNA (UAS) - Lentiviral mouse Mrps15 shRNA (UAS, iRFP) plasmid
GTR15295915 1 Vial

Lentiviral mouse Mrps15 shRNA (UAS) - Lentiviral mouse Mrps15 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse ASB13 shRNA Plasmid
abx980286-01 150 µg

Mouse ASB13 shRNA Plasmid

Sign In for Pricing
View Details