Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTF, Human (HEK293)

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Human (HEK293) is produced by HEK293 cells (M1-M200) with tag free.

Product Specifications

Product Name Alternative

CNTF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/cntf-protein-human-hek293.html

Purity

99.00

Smiles

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Molecular Formula

1270 (Gene_ID) P26441 (M1-M200) (Accession)

Molecular Weight

Approximately 22-29 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17 (7) :912-21.|[2]Pasquin S, et al. Ciliary neurotrophic factor (CNTF) : New facets of an old molecule for treating neurodegenerative and metabolic syndrome pathologies. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :507-15.|[3]Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18 (12) :773-789.|[4]Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293 (39) :15256-15268.|[5]Zurn A D, et al. Combined effects of GDNF, BDNF, and CNTF on motoneuron differentiation in vitro[J]. Journal of neuroscience research, 1996, 44 (2) : 133-141.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF740 conjugate, 0.1mg/mL
BNC742900-100 1x 100 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LRRC3 activation kit by CRISPRa
GA113054 1 Kit

Human LRRC3 activation kit by CRISPRa

Sign In for Pricing
View Details
General Purpose Incubator BIGP-609
BIGP-609 1 Unit

General Purpose Incubator BIGP-609

Sign In for Pricing
View Details
Recombinant MCM7 Monoclonal Antibody
AN302062L-01 50 µL

Recombinant MCM7 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant MCM7 Monoclonal Antibody
AN302062L-02 100 µL

Recombinant MCM7 Monoclonal Antibody

Sign In for Pricing
View Details
4 crank/ Manual 5 function medical bed BHBD-418
BHBD-418 1 Unit

4 crank/ Manual 5 function medical bed BHBD-418

Sign In for Pricing
View Details