Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glia maturation factor beta/GMFB, Human

Glia maturation factor beta/GMFB Protein, Human is a major component of glia maturation factor family, essential in brain development and responses to stress.

Product Specifications

Product Name Alternative

Glia maturation factor beta/GMFB Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/glia-maturation-factor-beta-gmfb-protein-human.html

Purity

99.00

Smiles

MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

Molecular Formula

2764 (Gene_ID) P60983 (M1-H142) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yin G, et al. Glia maturation factor beta is required for reactive gliosis after traumatic brain injury in zebrafish. Exp Neurol. 2018 Jul;305:129-138.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYK2 Polyclonal Antibody, Cy5.5 Conjugated
bs-3357R-Cy5.5 100 µL

PYK2 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
SCAND2 Blocking Peptide
33R-4123 0.1 mg

SCAND2 Blocking Peptide

Sign In for Pricing
View Details
Anti-TIMM17A antibody
STJ11100794 100 µl

Anti-TIMM17A antibody

Sign In for Pricing
View Details
Gpr149 (NM_138891) Rat Tagged ORF Clone Lentiviral Particle
RR205861L3V 200 µL

Gpr149 (NM_138891) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Dog CTXII (Cross Linked C-Telopeptide Of Type II Collagen) ELISA Kit
MBS8821417-01 48 Well

Dog CTXII (Cross Linked C-Telopeptide Of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details
Dog CTXII (Cross Linked C-Telopeptide Of Type II Collagen) ELISA Kit
MBS8821417-02 96 Well

Dog CTXII (Cross Linked C-Telopeptide Of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details