Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-3 (IL3) (Active)

Product Specifications

Product Name Alternative

Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3

Abbreviation

Recombinant Human IL3 protein (Active)

Gene Name

IL3

UniProt

P08700

Expression Region

20-152aa

Organism

Homo sapiens (Human)

Target Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Interleukin-3 (IL-3) is a potent growth promoting cytokine. IL-3 can stimulate the proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. IL-3 exerts its biological function through binding to specific cell surface receptors. The amino acid sequences of this protein among different species share relatively low identity and its activity is highly species-specific. IL-3 has also been shown to possess neurotrophic activity, and is thought to be associated with neurologic disorders.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 0.3-1.5 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)
MBS2070226-01 0.1 mL

PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)
MBS2070226-02 0.2 mL

PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)
MBS2070226-03 0.5 mL

PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)
MBS2070226-04 1 mL

PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)
MBS2070226-05 5 mL

PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)
MBS2070226-06 5x 5 mL

PE-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 10 (CHRNa10)

Sign In for Pricing
View Details