Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC84B antibody

Product Specifications

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Rnase10 Pre-designed siRNA Set A

SI211973A 1 Each

Rat Rnase10 Pre-designed siRNA Set A

Sign In for Pricing

Recombinant Rhesus Macaque TRIM21 Protein, His (Fc)-Avi-tagged

TRIM21-4768R 50 µg

Recombinant Rhesus Macaque TRIM21 Protein, His (Fc)-Avi-tagged

Sign In for Pricing

PDZK1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

bsm-62202R-BF647 100 µL

PDZK1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing

Rabbit Polyclonal CLIP170 Antibody [PerCP]

NBP1-76921PCP 0.1 mL

Rabbit Polyclonal CLIP170 Antibody [PerCP]

Sign In for Pricing

DNM1P33 CRISPRa sgRNA lentivector (set of three targets)(Human)

18454121 3x 1.0µg DNA

DNM1P33 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

MBS5818164 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

Sign In for Pricing