Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPZL3, Human (HEK293, His)

The MPZL3 protein is an important mediator of homogeneous cell-to-cell adhesion and promotes important interactions between cells. Its role in establishing connections emphasizes its importance in cellular cohesion, maintaining structural integrity, and facilitating communication between adjacent cells. MPZL3 Protein, Human (HEK293, His) is the recombinant human-derived MPZL3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

MPZL3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mpzl3-protein-human-hek293-his.html

Purity

95.0

Smiles

LEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSS

Molecular Formula

196264 (Gene_ID) Q6UWV2-1 (L32-S158) (Accession)

Molecular Weight

Approximately 15-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Inhibin Beta A (INHbA), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0027155 96 Tests

Multiplex Assay Kit for Inhibin Beta A (INHbA), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
UQCRFS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H8]
TA811461AM 100 µL

UQCRFS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H8]

Sign In for Pricing
View Details
Rabbit Polyclonal FBX09 Antibody [Janelia Fluor 635]
NBP3-21448JF635 0.1 mL

Rabbit Polyclonal FBX09 Antibody [Janelia Fluor 635]

Sign In for Pricing
View Details
Rad51ap2 Mouse Gene Knockout Kit (CRISPR)
KN514416 1 Kit

Rad51ap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FKTN Protein Vector (Human) (pPB-N-His)
PV078542 500 ng

FKTN Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CLEC1A (C-type Lectin Domain Family 1 Member A, C-type Lectin-like Receptor 1, CLEC-1, CLEC1, UNQ569/PRO1131, MGC34328) (MaxLight 650)
125059-ML650 100 µL

CLEC1A (C-type Lectin Domain Family 1 Member A, C-type Lectin-like Receptor 1, CLEC-1, CLEC1, UNQ569/PRO1131, MGC34328) (MaxLight 650)

Sign In for Pricing
View Details