B4GALT1, Human (HEK293, Y285L, His)
B4GALT1 Protein, Human (HEK293 His) is responsible for the overcoming multidrug resistance in human leukemia therapy via regulating the activity of the hedgehog signaling pathway[1][2].
Product Specifications
Product Name Alternative
B4GALT1 Protein, Human (HEK293, Y285L, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b4galt1-protein-human-hek293-his.html
Purity
99.90
Smiles
GRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPSHHHHHH
Molecular Formula
2683 (Gene_ID) P15291-1 (G44-S398, Y285L) (Accession)
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Huyang Xie, et al. Increased B4GALT1 expression associates with adverse outcome in patients with non-metastatic clear cell renal cell carcinoma. Oncotarget. 2016 May 31;7 (22) :32723-30.|[2]Huimin Zhou, et al. B4GALT1 gene knockdown inhibits the hedgehog pathway and reverses multidrug resistance in the human leukemia K562/adriamycin-resistant cell line. IUBMB Life. 2012 Nov;64 (11) :889-900.|[3]Claudia De Vitis, et al. B4GALT1 Is a New Candidate to Maintain the Stemness of Lung Cancer Stem Cells. J Clin Med. 2019 Nov 9;8 (11) :1928.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-69126 10 mg
Rabbit Polyclonal Rabbit anti-Mouse IgE Fc Secondary Antibody (Azide Free)
Sign In for Pricing
View Details RC224346L4V 200 µL
OR2A7 (NM_001005328) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS8107727-02 5x 0.1 mL
Anti-Gastrokine 1 Antibody, Rabbit Polyclonal
Sign In for Pricing
View Details